PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi10g05520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Trihelix
Protein Properties Length: 557aa    MW: 62568 Da    PI: 7.985
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi10g05520.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix33.61e-10961432269
         trihelix  22 rrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69 
                       +++  ++ W++vs+k+ e gf++s+++Ckek+e+ ++++ ++ +  k
  Vradi10g05520.1  96 MENCFPEHTWDHVSRKLGELGFKKSAEKCKEKFEDESGYFDNVSNYGK 143
                      56788899********************************99877655 PP

2trihelix96.91.8e-30418503185
         trihelix   1 rWtkqevlaLiearremeerlr..rgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                      rW+++evlaLi++r    ++++  +g+ k+plWe++s+ m+e g++rs+k+Ckekwen+nk+++k+k+ +kkr s +s+tcpyf+ql
  Vradi10g05520.1 418 RWPRDEVLALINLRCTSVSNSEekEGNNKGPLWERISQGMSEVGYKRSAKRCKEKWENINKYFRKTKDVNKKR-SLNSRTCPYFHQL 503
                      8***********997655555512689*********************************************8.89999*******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138375.4E-20417503No hitNo description
CDDcd122031.57E-23417484No hitNo description
PROSITE profilePS500906.353418477IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MCSWPCSVTV CKRPLHSKRL HVLAAVPVRR HCIPLYQLKI PILKSSVPLS ASFHVSCHPY  60
AVNYTIVTVT HSYSLPLSFP RASTSSLTCP RIRSTMENCF PEHTWDHVSR KLGELGFKKS  120
AEKCKEKFED ESGYFDNVSN YGKNNYRFLS ELEELCQNPD SAGGGGGDCD GDDGIVRSEK  180
TLLHLGADNM GHRQCDGTDD KVVVEKSKER KRKRRDRFEM FKGFCESFVN KMMAQQEEIH  240
NRLLEDMVKR DQEKFAREEA WKKQEMERMN KELDIMAQEQ AIAGDRHATI IEFLKKCATT  300
TSTTSQNANG SSLPNRSLLH SLNPNSPSNE DNNLDPTPTL LNHDQTKLLR AENPSSSETL  360
LQVPSSSNSS PTPHNPSSSL NSQNNTIPLE SNSVSTYKTT STTPPGRTEN SKDDVGRRWP  420
RDEVLALINL RCTSVSNSEE KEGNNKGPLW ERISQGMSEV GYKRSAKRCK EKWENINKYF  480
RKTKDVNKKR SLNSRTCPYF HQLSCLYGQG KIVAAQSERE GNYMSPTANS GQVPPDVDDE  540
DESSHVGSGG LDHYAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209214RKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517158.10.0PREDICTED: trihelix transcription factor GTL2-like
SwissprotQ8H1813e-76GTL2_ARATH; Trihelix transcription factor GTL2
TrEMBLA0A0L9VDH20.0A0A0L9VDH2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S5560.0A0A0S3S556_PHAAN; Uncharacterized protein
STRINGGLYMA19G43280.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50433355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28300.17e-72Trihelix family protein